SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386761654|ref|YP_006235289.1| from Helicobacter cinaedi PAGU611

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386761654|ref|YP_006235289.1|
Domain Number 1 Region: 73-226
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.98e-26
Family N-acetyl transferase, NAT 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386761654|ref|YP_006235289.1|
Sequence length 242
Comment arginyl-tRNA-protein transferase [Helicobacter cinaedi PAGU611]
Sequence
MRLVEFYSEEKTCSYIDSKKSIFRYFHIQNVKPSFYHGLLERGFRRFGNYFFVPMCQGCN
DCISIRTLIDDFKFSKNHKRVLKKAQNIDIQIQKPTISQAHIELYNRYHQTMRDKKGWDY
TPTTPESYMDMFVDGHQDFGYEFLYFIDSQLIGVGLVDALGQSITAVYFYYDHNFSHYSL
GTLNILKQISIGREFGLKYFYPGYWIKNHYCMGYKERFTPFEVLKNAPDIFEPPIWELYI
KE
Download sequence
Identical sequences gi|386761654|ref|YP_006235289.1| WP_014666718.1.82988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]