SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386762429|ref|YP_006236065.1| from Helicobacter cinaedi PAGU611

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386762429|ref|YP_006236065.1|
Domain Number 1 Region: 362-500
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.25e-25
Family N-acetyl transferase, NAT 0.0067
Further Details:      
 
Weak hits

Sequence:  gi|386762429|ref|YP_006236065.1|
Domain Number - Region: 172-281
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.000439
Family UDP-N-acetylglucosamine 2-epimerase 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386762429|ref|YP_006236065.1|
Sequence length 520
Comment hypothetical protein HCN_1784 [Helicobacter cinaedi PAGU611]
Sequence
MRIDIFCESGEGYGLGHFYRSLKLIAIFVKLTKLPYIHAITLHNRGDYTPPSLNTLLDST
LSHIELECKNYEWLSTQPEMLELAIVDSYEAQEWFYHRLIQHSKALICLDDTLRDVYPKD
CYILNPTPDSKSYFKGYSHLWCGEEYMILPQHIESKPLESAQDSKPTAHNQNKQIFVNFG
GVDLSNLSQRFIDLLADLLMSVPVGQCHFHLVLGGGYPHKIAIPKPLENFISMYHNLTPS
EFLHLALTCDYALSAGGGSMLELLRLKIPSVILQTAQNQAFHIEQWQKKGVIYHAKDLPS
ALETLFSWQENPPKILKQNLQNLNLGSKLESALLSLIQNLATPHSTAQNETAKIQALPFP
KLNPTQSQAILQMRNHPDIAKWMYATFISPESHTAFLANLANDNTKRYWLLQENDEYIGV
GSLTRINLTHRHAFIGIYKNVDSSISRKGAKILKFLESYAFNELGLHTLHLEVLQHNTQA
IAFYEKMGYTKEGILHDFIREIKDSQSIYHNVILMYKERV
Download sequence
Identical sequences I7HG67
gi|386762429|ref|YP_006236065.1| gi|471316560|ref|YP_007601915.1| WP_002955753.1.1385 WP_002955753.1.82988 WP_002955753.1.88286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]