SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410656879|ref|YP_006909250.1| from Dehalobacter sp. DCA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410656879|ref|YP_006909250.1|
Domain Number 1 Region: 8-296
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 4.51e-48
Family Methylenetetrahydrofolate reductase 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410656879|ref|YP_006909250.1|
Sequence length 520
Comment 5,10-methylenetetrahydrofolate reductase [Dehalobacter sp. DCA]
Sequence
MENAFRKSIQDNNEFIVTWELVPGRGSKEVSQEKALQLAEQAAKGKKIHAVSLTDNPGGS
VGINPEGIGREIKGLGLDAIIHVACKDKNRTQLESQLFSLERSGLHNLLVLTGDHDPGNF
FGRPKPVFDLDSTQLLAFIAKMNDGLELPTAKGVHKLQPTHLFAGAAVSPFKATEAEQML
QYTKLRKKIENGAQFIIPQVGYDVRKYHELYQFVKHNNLHGCLMGNIYLLTYGAAKAMSM
NKVPGCVITDKLVAELEQEKQSSDKGAAAMLDRAAKLFAILKGMGYKGVHLGGHNTTYEQ
VEYIIDRGNELAANWQDYVREFDYPQKNGFYVYAKDEKTGLNTAQKSNDYNNYEKSFDLN
YKMSRVVHKMMFEPNKGMFGFMRGFCHAIKDSALEKPFHGIEHLAKSCMYNCQDCGDCAL
IDVAYVCPMGNCPKNQRNGPCEGSYNGWCEVYPNKQKCIWVKAYYRLKGYSEEEKLNSYH
VSPYNWEKQHTSGWINFFEGQDHSAERLGIKPRTNFEEKE
Download sequence
Identical sequences K4LCX7
WP_015042310.1.6016 WP_015042310.1.71633 gi|410656879|ref|YP_006909250.1| gi|410659917|ref|YP_006912288.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]