SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410657233|ref|YP_006909604.1| from Dehalobacter sp. DCA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410657233|ref|YP_006909604.1|
Domain Number 1 Region: 13-85,164-334
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.43e-62
Family Bacterial dinuclear zinc exopeptidases 0.00000437
Further Details:      
 
Domain Number 2 Region: 75-172
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 0.000000000000214
Family Aminopeptidase/glucanase lid domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410657233|ref|YP_006909604.1|
Sequence length 334
Comment Cellulase M-related protein [Dehalobacter sp. DCA]
Sequence
MTDTKPLDPLDFTLLQQLTQTFGPSGQEHNVAALILDQTKNYADTAYTDTLGNLIVRKKG
QGRKMMIACHMDEVGIMVTHINKQGYLYFAPVGGLRDHVLLAQRFVFANGAVGVVSREEK
KKPDENSPERLFLDLGATSEQEARTMVREGDMAVFSGAYQETKDCMISKALDNRAGCFIA
LEVLKRVSSQDDLYFVFTAQEEVGARGAKTAAYALEPDLALNIDTTFSFDMPREYEVPRT
SLNKGIAIKVMDRSIVVSPQIKNWMAEIAEQHEIPYQWEIITNGGTDSGPVHLTKGGIPT
GGLAVPVRHLHTPGEIASKNDIRSGISLLLALLE
Download sequence
Identical sequences K4KZL5 T0HYZ3
gi|410660269|ref|YP_006912640.1| WP_015042661.1.6016 WP_015042661.1.71633 WP_015042661.1.88763 gi|410657233|ref|YP_006909604.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]