SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|410657586|ref|YP_006909957.1| from Dehalobacter sp. DCA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410657586|ref|YP_006909957.1|
Domain Number 1 Region: 72-214
Classification Level Classification E-value
Superfamily FMN-binding split barrel 1.28e-36
Family NADH:FMN oxidoreductase-like 0.0000366
Further Details:      
 
Domain Number 2 Region: 2-36
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0000000000236
Family Rubredoxin 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410657586|ref|YP_006909957.1|
Sequence length 220
Comment hypothetical protein DHBDCA_p945 [Dehalobacter sp. DCA]
Sequence
MKWRCVVCGYIHEGDNPPEACPVCGVDSSNFVRVEEETKQNENSKNDSVKNDEAALTSPA
QTGLSPEEKIVKAVQSISYGLFIITAAYNGKDNGQAANTCFQITSDPVQIAIGINKKNYT
HELIMQSGKFGISVLDQNGHDLVRRFGYRSGRDADKFEGIKAHRGPSGIMLPNEVLTTMD
AEVVNSMDTGTHTLFLGRVTAAEVRGSGEPMTYAYFRKTK
Download sequence
Identical sequences K4LEK4
gi|410657586|ref|YP_006909957.1| gi|410660622|ref|YP_006912993.1| WP_015043011.1.6016 WP_015043011.1.71633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]