SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410658807|ref|YP_006911178.1| from Dehalobacter sp. DCA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410658807|ref|YP_006911178.1|
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily L28p-like 8.83e-25
Family Ribosomal protein L28 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410658807|ref|YP_006911178.1|
Sequence length 63
Comment LSU ribosomal protein L28p [Dehalobacter sp. DCA]
Sequence
MASICDVCGKGVSSGMSVSHSHIRSKRTWKPNLQRVRAVVNGTPTHVKVCTRCLRSGKVK
RAI
Download sequence
Identical sequences K4L6Y0 T0I5B7
gi|410658807|ref|YP_006911178.1| WP_015044215.1.48873 WP_015044215.1.6016 WP_015044215.1.71633 WP_015044215.1.83799 WP_015044215.1.88763 WP_015044215.1.89380 gi|410661793|ref|YP_006914164.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]