SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410658824|ref|YP_006911195.1| from Dehalobacter sp. DCA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410658824|ref|YP_006911195.1|
Domain Number 1 Region: 5-284
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 8.83e-90
Family Methylenetetrahydrofolate reductase 0.00000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410658824|ref|YP_006911195.1|
Sequence length 302
Comment 5,10-methylenetetrahydrofolate reductase [Dehalobacter sp. DCA]
Sequence
MFISELFQQKKVVSFEIFPPKLTSSIEVIYDTIDALAPLRPDFISVTYGAGGSTSKTTAE
IASIVENKYNINSLAHLTCITSSKEQIEGTLTQLADSNVSNILALRGDIPKGSEETGRAR
DFQYASDLVAYIQDKHSFCLGGACYPEGHPECPDKDQDIENLRRKVDAGVGFLVTQLFYD
NDAFFRFQEKVANLNINVPILAGIMPITNRVQIERILALSNARMPQKLIKILDKFEHNME
ALKDAGIAYATKQIVELLANDIDGVHIYTMNKPQIAKDLVRNLDSLFYAVNSQETRKEGN
LA
Download sequence
Identical sequences K4L6I1 T0HWV2
WP_015044232.1.6016 WP_015044232.1.71633 WP_015044232.1.88763 gi|410661810|ref|YP_006914181.1| gi|410658824|ref|YP_006911195.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]