SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410658061|ref|YP_006910432.1| from Dehalobacter sp. DCA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410658061|ref|YP_006910432.1|
Domain Number 1 Region: 3-216
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.78e-62
Family Phosphate binding protein-like 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410658061|ref|YP_006910432.1|
Sequence length 223
Comment ATP phosphoribosyltransferase catalytic subunit [Dehalobacter sp. DCA]
Sequence
MPKNYLTIALPKGKLLTDSVALLTEAGLDCRSVENDSRKLLFDLPGSEARIIICRPTDIP
TYVEQGAADIGFVGKDTVIEQNKDVAELVDLKFGYCRFVVAMPEESLPQKLPDGLYDLSV
LNHKRAATKFPRVAQLFFNEHGMQVTPIKLHGNIELAPRVGLAEMIVDIVSTGKTLKENN
LAEVAQILEATSRMIANRVSYRVKYERIQGLAEKMRVLVQQYD
Download sequence
Identical sequences K4L4A6 T0I964
WP_015043481.1.6016 WP_015043481.1.71633 WP_015043481.1.88763 gi|410658061|ref|YP_006910432.1| gi|410661050|ref|YP_006913421.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]