SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410659103|ref|YP_006911474.1| from Dehalobacter sp. DCA

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|410659103|ref|YP_006911474.1|
Domain Number - Region: 31-85
Classification Level Classification E-value
Superfamily YheA/YmcA-like 0.0366
Family YmcA-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|410659103|ref|YP_006911474.1|
Sequence length 108
Comment hypothetical protein DHBDCA_p2462 [Dehalobacter sp. DCA]
Sequence
MISLDEALVIYTDKITSGQDIDYNYFYENLAQDDIEEFKELSKIINMTISVPYTQEFDAV
FKKINDYKEQLYSLPQAADFRKDRKDSDGNDDAQRIIDELFNEEFSDE
Download sequence
Identical sequences K4L4L7
WP_015044506.1.6016 WP_015044506.1.71633 gi|410659103|ref|YP_006911474.1| gi|410662089|ref|YP_006914460.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]