SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410659389|ref|YP_006911760.1| from Dehalobacter sp. DCA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410659389|ref|YP_006911760.1|
Domain Number 1 Region: 105-307
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.81e-19
Family Phosphate binding protein-like 0.01
Further Details:      
 
Weak hits

Sequence:  gi|410659389|ref|YP_006911760.1|
Domain Number - Region: 7-53
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000104
Family Excisionase-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|410659389|ref|YP_006911760.1|
Sequence length 317
Comment DNA binding domain, excisionase family [Dehalobacter sp. DCA]
Sequence
MLESTSYTPEEVAQKLKISKYTVYELIKRGDLAAYRVGRKVRVEDKDIEAYIQKSKGASM
TTDVFTYPVLERSSEPGRSPDVSISDTVVICGQDIILDILTRHLLKQYPNIKFLRSYIGS
IDGLLALYRGEANIVTVHLWDSDADDYNLPYIRRLMPGHQTIVINLVYRQEGFYISRGNP
KDITSWKDLTRPDVRFINRERGSGARVLLDEKLRIESIPHHLINGYYDEEMSHMAVASNV
ARGEADVGLGIEKAAMQVSGLDFIPLKTERYDLVMRQEDLNKPHFQALLAIIRSEAYRKE
VKGLGGYDVSRMGEMME
Download sequence
Identical sequences K4L843 T0JBA5
gi|410659389|ref|YP_006911760.1| gi|410662375|ref|YP_006914746.1| WP_015044789.1.6016 WP_015044789.1.71633 WP_015044789.1.88763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]