SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410659439|ref|YP_006911810.1| from Dehalobacter sp. DCA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410659439|ref|YP_006911810.1|
Domain Number 1 Region: 40-275
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.99e-70
Family Phosphate binding protein-like 0.00000704
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|410659439|ref|YP_006911810.1|
Sequence length 278
Comment Phosphate ABC transporter, periplasmic phosphate-binding protein PstS [Dehalobacter sp. DCA]
Sequence
MKKLFTLILVGILALAFTGCGSKDSTSQSDQQQAQTESAEITIAGSTSVQPISEALTEAF
MAKNPNIKVNVQGGGSGAGIKAAQEGTADIGSSSRELKPEETGLTETVICKDGVAIVVNS
KNVVKDLSIEQIKKIYSGETTNWKEVGGASQTINVITREAGSGTRGAFEELVMGKDNPIS
DKAIVQNSTGAARTSVAGDVNAIAYISMASIDDTVKAVTVEGIEANAKNVLNGSYKIQRP
FLYLTKAAPSGAVKTYIDFVMSDQGQSIIQKEGLVLVK
Download sequence
Identical sequences K4LJL2 T0I7K2
gi|410662422|ref|YP_006914793.1| WP_015044837.1.6016 WP_015044837.1.71633 WP_015044837.1.88763 gi|410659439|ref|YP_006911810.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]