SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410659474|ref|YP_006911845.1| from Dehalobacter sp. DCA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410659474|ref|YP_006911845.1|
Domain Number 1 Region: 41-383
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.25e-30
Family Phosphate binding protein-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|410659474|ref|YP_006911845.1|
Sequence length 393
Comment hypothetical protein DHBDCA_p2833 [Dehalobacter sp. DCA]
Sequence
MEKRLKALPCIMIIILSLTALTACSKGPSPGKPGGDAPAVISVWYSLDGKEEQALLAQFA
RINKEYPEVSVKGERIAEADIVQQVWNYQAGAEGPEIVIARRQILDALYKKGAVSPVLAD
IDSAYPAARAVFTYNKQAFAAPWLTDVPLLYYRKDKVPVPPASLAEIWEKHSVIAVPGLN
ASLLSPWWRAEGGTLSTNGIPALNSQKNRAFINNFAALRQQNQVLLDSAALARFAGGETG
YLLTWASDSTKLTNIGGNWDCLSFYSLLGAKGQVLLDHTIGIANSSIKTIPAMESAIRLV
EEELLKPAAEEAMFQAGGRLPVNSAYYESAAKRFQSEVALSLQSAWYLEGSVNDWTYLDL
LNSSWQNIAGGANMESELARIQQDASDIGKQTK
Download sequence
Identical sequences K4L5P9 T2RMI9
WP_015044870.1.6016 WP_015044870.1.71633 WP_015044870.1.88763 gi|410659474|ref|YP_006911845.1| gi|410662454|ref|YP_006914825.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]