SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|532365646|ref|YP_008454045.1| from Rhodococcus erythropolis CCM2595

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|532365646|ref|YP_008454045.1|
Domain Number 1 Region: 1-271
Classification Level Classification E-value
Superfamily DAK1/DegV-like 6.02e-68
Family DegV-like 0.0000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|532365646|ref|YP_008454045.1|
Sequence length 280
Comment hypothetical protein O5Y_17405 [Rhodococcus erythropolis CCM2595]
Sequence
MPVVVVTDSSACIPQESADACGIQVVPLHVLRDGCDLREGVDAMPSDLSGVTTAGASPAE
LSEAYARALDMSDGDGVLAVHISRQLSGTWEAGRVAAQEFGGAVRIVDSQSAGMGLGYPA
LEAARLAEKGASLEEAYGRAVDVASRGRCYIVVDKLDQLRRGGRIGTAAALLGTALAMKP
ILHLVDGKLVLGEKTRTTTKALARLVDSAVERAGLGRVAIAVHHMRARERADAIAEQLAE
RIPDVAESVVTDFSAVIGAHVGVGAIGVVVCPLPEIDTSA
Download sequence
Identical sequences A0A0C3A8W8 A0A0U2R0Q2 C1A1J5
234621.RER_37720 gi|226307259|ref|YP_002767219.1| gi|532365646|ref|YP_008454045.1| WP_020908214.1.2937 WP_020908214.1.58082 WP_020908214.1.61491 WP_020908214.1.69155 WP_020908214.1.77150 WP_020908214.1.78616 WP_020908214.1.79292 WP_020908214.1.83724 WP_020908214.1.98030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]