SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT00295 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT00295
Domain Number 1 Region: 154-249
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-18
Family B3 DNA binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 673-754
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000216
Family B3 DNA binding domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT00295
Sequence length 774
Comment pep:novel supercontig:GCA_000347335.1:Scaffold263657:37728:44118:-1 gene:F775_19971 transcript:EMT00295 description:"B3 domain-containing protein "
Sequence
MEKTRRFKSERPSIVKEMKHIDVYALVLHETEVCGICKGPIMVHQQKQYSNMGMIDDKQN
VKVKEGGGENTNAKEKKKQSKEEGDKKKEVKKMTKYKEKKERMRGNDKDNEKEKEDQRKM
KENEKKMRAHKEREEKKENDKEEELKEQNDTKNCPQFFRSLMTSSSMEQETIPEDCHKYL
EECTGTVSLRGPSGNLWPVELAKISGELCFARGWKEFLCDHCIVYGYLLVFRYDGNSQFS
VTVFSPSSCEAPYAFLAQPQRMGATAVAAHDEDGDTGTNADGTAPQEEDSHIGTAADGTP
QNEGEEEEDASEEYEGSDNMSVDADGAGPQKEEEDALSENPDNEEESEWRSAPLQQQKED
QDKIDNGFVVGKRTRFRKVDDIMTEVVRSKKSKAKEGKRHEAQSSDSKSEGEALGDSLAK
LGLRPPRKSKATEEKRPEAPSGDSLAELVRRSPKKSKAEGKRSTALASKGAASSDSLKES
KRRPPRKPKAAKGKRPRAPCGHSESEGAASGDSLAELVRRPPKKSRTEGKGSAASSASKG
MTSSHSLAGVFAPESVCKDLTKLHKSFGKKHSMKAQFPMFNKSNSENQPGRVIVKVQRRP
ELESQRRPITQRDKEYAMERARRFQSKRPFVIKEIKHTDVYVSYFMVIDQILLWMDTHIL
KLHCSLTDRPGTLQIIPDMFVENFLLKESRKMTLWDPQAKPWKVWYEYTGGECPRAAFSA
GWGALAMENYLENRDLCVFELLDDDYNIKLHVYRAVLDITPFALAPKHRQQGCA
Download sequence
Identical sequences N1QP54
EMT00295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]