SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT00915 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT00915
Domain Number 1 Region: 27-105
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000014
Family Protein kinases, catalytic subunit 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT00915
Sequence length 138
Comment pep:novel supercontig:GCA_000347335.1:Scaffold184358:11528:11944:1 gene:F775_25718 transcript:EMT00915 description:"Serine/threonine-protein kinase PFTAIRE-2 "
Sequence
MPTAIRKRPALGQEPRVHGGKKPRYAFGSISDYEKLEVLGEGTYGEVFKARDRRTGKKVA
VKWVRGNGAGGHGPPDIRAITREAGCLGACRGHESIIEILDVATDAETGTCSSSWSSSPT
AAPSASHSGGLYPRRRPA
Download sequence
Identical sequences N1QSF1
EMT00915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]