SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT01369 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT01369
Domain Number 1 Region: 85-146
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000785
Family SIAH, seven in absentia homolog 0.0051
Further Details:      
 
Domain Number 2 Region: 14-68
Classification Level Classification E-value
Superfamily RING/U-box 0.0000273
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT01369
Sequence length 174
Comment pep:novel supercontig:GCA_000347335.1:Scaffold157549:10728:16397:1 gene:F775_16875 transcript:EMT01369 description:""
Sequence
MAAVEAEEVEAVSLALPKKLFHCAACLAPLKPPVFRCGSEHFVCQACVSGGDGNGGTNKR
CGPCGHAVSYTRSRFMDGVVDAYKVPCLYKGHGWAMDGIPYHSAADHKASCKHAPCYCFD
CRFVGSPAKLVRHLASPSGAHAWPVEKISKHNLKYLNWRPVDLHGSWLRAQRTS
Download sequence
Identical sequences R7VZ71
EMT01369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]