SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT01422 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT01422
Domain Number 1 Region: 146-243
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.65e-19
Family B3 DNA binding domain 0.0014
Further Details:      
 
Domain Number 2 Region: 619-687
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000141
Family B3 DNA binding domain 0.0075
Further Details:      
 
Domain Number 3 Region: 567-618
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000155
Family B3 DNA binding domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT01422
Sequence length 714
Comment pep:novel supercontig:GCA_000347335.1:Scaffold155490:35749:39207:-1 gene:F775_10319 transcript:EMT01422 description:""
Sequence
MGMVDNKQNVKVKEEEDENLNTKEKRKQNKAEGGKKAEEKQNSSKRKMDKNREEKEKKTR
VVDKKDDEEKEREDRRKRKENEKKVKSHRERKEENENEKEEQGQQEIEKEKVEEQKEINK
QKGRKENDKEEEDSKERDEKDQNDKKNCPHFFRALISYSFKEHVTIPVGFHKYLEDCTRM
VSLRGPSGNKWPVELAKISGELRFARGWKEFLSDNRIGYGYLLVFRYDGQSQFSVTVFLP
SSCEAPYAFLAQPQRKDVDVAGEEEKGLMSTNVDGTVLQGEDVHTGTSADGTPQNEALEE
DASEDEEVEEVEDALSETPENKEDSECRMCSDDALEPAQQQQGDLRKTDDGFVLGKRARF
RKVDDIMAEVDRSKKSKPVERKNSEGPSGDLASEGAASSDSLAEESEHRPPKESKAEVIR
SPSSDSPSKAATSSDNFAELDSRPSKESKAEGKSSVGPLVVYTRPSTSASKRLPLKKASE
ETISSDNLAGVFAPESVCTDLTMWHNSFGKRLSKQNQFPMFNKSNGENQPGRVLIKVMRR
SGLTSQRRPVTQREKEYAMERAQRFKSERPFTVKAMKHNDVYASYFMIIPDKFVKTFLPK
ESRKMTLWDPQAKPWKITPKKLLRTFHPRESTKMTLWDPQAKPWKVWYEYTGGECPRAAF
SAGWGALAMENNLEKWDVCVFELLDQEYNIKLHVQKVVLMITPCILAPKPRTNE
Download sequence
Identical sequences R7W2I6
EMT01422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]