SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT01554 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT01554
Domain Number 1 Region: 305-393
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000353
Family B3 DNA binding domain 0.0057
Further Details:      
 
Domain Number 2 Region: 25-105
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000569
Family B3 DNA binding domain 0.01
Further Details:      
 
Weak hits

Sequence:  EMT01554
Domain Number - Region: 132-217
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0294
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT01554
Sequence length 394
Comment pep:novel supercontig:GCA_000347335.1:Scaffold149805:4275:6088:1 gene:F775_23610 transcript:EMT01554 description:"Putative B3 domain-containing protein "
Sequence
MGSSGNYGMRTKMQQMVKLTASKYLRINDETARWFDTGDRGAEHKAHIMSPFGKKPWGIT
VGARAKGLCWGDGWPQFVAAHGIGVGCYLVFKHVLRGTVTLKVFDDGFVIKPFGLTITVL
SPPEIENAFARKPQFIVPFQTSFKEKMPIPPEFLRRGYISEEDLNRPKPAAIFSTSWHID
LEKDGPNVFFAGPLWPKFLEHKNLSETHVLLIKPMDMGIMSTLSKKQARLSKASNIKLIT
TIVLSAPGAQSQEEEHVSTPKTPKRKRSKSERMVESPTTSGHLNKKTKCVYELGSAGSQA
WLRKTISSGSVLKKCSLPRPFGFVESCKIALKPMESDNSWEVEGVALSPGTRKATNRLVT
GWPKFCKENGLKAGDTCTFKVVDSTLWHVVIDRC
Download sequence
Identical sequences N1QPJ3
EMT01554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]