SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT01571 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT01571
Domain Number 1 Region: 195-304
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000902
Family B3 DNA binding domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT01571
Sequence length 433
Comment pep:novel supercontig:GCA_000347335.1:Scaffold149514:4876:6177:1 gene:F775_11251 transcript:EMT01571 description:""
Sequence
MTPVPRNPFSSGLRHGDADAAQAQSKPIIIPTTDPERIDKSLLPLKKRATSDSSDREDSS
FLVPLLPKKKRVDAGSEIPVQTHQNLLCQTVTVVRTSAFSPNATTPRQHKLTSGGDEQLL
HVTRPRRPAACDGAYVGTEEDETAPAKKKKKKKEDRSRDRKKKSLPARVAAPPPLRLSTG
LTQHLETLGATAPQFVCVKTLQKSDVDLNQNRLLFSCKRASIQRHPITGLLSHKETYLVH
EWKDGRRVTAFDDHGNEFGFKLRYLRSNGAYRFIGDWGDFVTEHGMQIHVDVELWAFRSP
SLPVQPKLPDQDKQRRLDGLQGHPDGALGLLLLFQVQHHDARNVHHAEEGKERAPAPRPV
HETKREASARQDNLADAHMSQNITSEDMVTAVGKEMADALMGLLMLRSICLRSKTDPYLL
GQDFDPKFTLSTS
Download sequence
Identical sequences R7W435
EMT01571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]