SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT01685 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT01685
Domain Number 1 Region: 402-502
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-23
Family B3 DNA binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 249-344
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-19
Family B3 DNA binding domain 0.003
Further Details:      
 
Domain Number 3 Region: 587-688
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.9e-17
Family B3 DNA binding domain 0.0026
Further Details:      
 
Domain Number 4 Region: 149-231
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000141
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 5 Region: 918-1076
Classification Level Classification E-value
Superfamily DNase I-like 0.0000000000000981
Family Sphingomyelin phosphodiesterase-like 0.02
Further Details:      
 
Weak hits

Sequence:  EMT01685
Domain Number - Region: 745-811
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00569
Family B3 DNA binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT01685
Sequence length 1269
Comment pep:novel supercontig:GCA_000347335.1:Scaffold145228:16646:24985:-1 gene:F775_00424 transcript:EMT01685 description:""
Sequence
MGFAVPGGGDGADPGAPSASTPPATRSSARNRTRRDGVGGGGVSLRRNTVVRCRFWEGMR
TRKKKKKKKKVIWVFARGLGVGISNSYFQFVTCCHTMKTSFTSCNECVVFARCCHTMKTS
FTSCNECVVYHNWHRMGDWKKCFVKIVGEFVDVPINLANYIRGQIPDKVKLEVPDGKTYN
VQVSKEENGLVFQSGWAEFARTYELVQGTILLFESSGSSCFEVRMFNQTGCEKELSCVPM
NNTPCVNKMRFFMVMMGIGASNNGLTIPEKFANYVRGHISEEIKLEVPDGQTYSVQVDNE
QNELVLLSGWDTFVSAYELKEGDTLLFGYNGNSQFKVRIFNVNGFDKLLSCVVKNITPCV
QKRSAYHDNPLQSPRERTGPNDHRNKACTICIECVGRHYWHMEDHNWSFFKVVILSNFKD
EMTIPPKFATNFRGRISDEVKLEVPDGKIYNVQVAEEQHKLVLRSGWANFAGAYELKEGD
LLVFTYSGDSHFKVKIFKPSGCENEFSCVTMSCGSNVQERDICHDQSLPTKKRCRNDAED
VTSSKDIQEPRGSGVLQGSSESRYILEMSCKLTSAQRARVDTFVKESQTGIEFYVTAMNE
KTLSDGYLVICKDYAVKHLPHQDQMIKLCHPQNSKTWDANLAVISDGTCTLSCILTAGWL
GFVRDNNLREGDICAFEVSKNDSRVMITVHPLKESGHPEYVITGHTKPASQQKKKWTHPG
YVVARSIKLTRKQKRKIEERIQAIRPEIKIFVSVLQRSSYSLGYADCHLPREDQIMRLRL
PGKNDTWKAKLYVGDKVNGKFNALRRGWKKLSVIVIALCMIFFRDIEVSTAERALEMIRN
VAVVKPMNDSDIDALGVRVFDSFCADLAPSLPETEEDDCSISPRDSILADSQVVRSTELG
CEDRVEDQNKPKRKWKRRSGGILLGVKCDTLEVRNVVMGDFTVKFRVRSKADGFNWALVV
VYGAAQPELKPAFLADLVRICGSGQLPILVGGDFNIIQRQEEKNNDNFDGRWSFMFNTII
ESLDLREIELSGRKFTWANTLPTPTFEKLDRVLSSVEWEQKFPLVTVQELSHAISDCRCT
KVGTFLYPFTCARAVVAAPAAGLGGAEEGKIQGCRGSAQARSMKSEGTRPASLDENQKTK
TPGKILRGRPKTPGKTLAGDAHKIPARPLPGASARPRLGPHLPEVRCPAPALMWRPAHQL
GEHLRGSMQLLGQLAKHLRGGMQIFVKTLPPHQLSSQLANVVLHASSAWMRVRTRRGGDG
RDELPCCPR
Download sequence
Identical sequences R7W054
EMT01685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]