SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT02356 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT02356
Domain Number 1 Region: 572-847
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.91e-58
Family Nitrogenase iron protein-like 0.068
Further Details:      
 
Domain Number 2 Region: 21-271
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.7e-55
Family Protein kinases, catalytic subunit 0.00065
Further Details:      
 
Domain Number 3 Region: 913-1289
Classification Level Classification E-value
Superfamily L domain-like 2.21e-23
Family Internalin LRR domain 0.094
Further Details:      
 
Domain Number 4 Region: 273-362
Classification Level Classification E-value
Superfamily PapD-like 0.00000017
Family MSP-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT02356
Sequence length 1333
Comment pep:novel supercontig:GCA_000347335.1:Scaffold126470:42277:48371:-1 gene:F775_23909 transcript:EMT02356 description:"Disease resistance protein RPP13 "
Sequence
MRDQSVLERILNGDEEPKDLPLALLQDITNDFCEENKIGQGGFGEVYKTRIAEAGSDDFK
LVNVRERLLCFEYISNGSLDKHITDELRGLQWEKRYDIITGICNGLRHLEEKEIIHMDLK
PANILLDDHMVPKITDFGLSRPNENSHTMGPRFGTRGYVAPEYDNAGKTSVKSDIYSFGA
IIIELVTGFMGIPDKNNVLRRWRHRWSKSPTLLQYQQLTRCMEIAVRCRQQEPEARPSIM
DIINYLSKSESTDVHTDQIQIHWLANHKPSRPSQQYTTRPGKGIVPPGCNEHLVQITVQA
QRQDRAPQVTQNGDKFIIQSTKVSNLRDEDITEHIFHEEAGKMVDEVNLMVKYEPVSRQD
PSLPAEAVSLMDINSSIYKDGVQGQCHKELDRRDFHLPEEFSQSQPTNMTYLLRVSDRAV
DVTRGAMGSLLHKLGELIKEDFNLEASVKKDVQSLSGELVTMQLVLRKVSEVQRGNLDDL
VKRWASNVREMSYDLEDFVDGFLVQSQPESSTSGFRELTHEICFHLEKGKSHHTIGNLIK
DKSKQVQDAAKKCKEYKVDNVVPNASAKAAIDELRILAMYEDKEQLVGINRPRDELIRLF
EEDGDVSKENLKIVSIVGLGGLGKTTLAKAVYDELKAQYHLKTFVLVGQNPDVKKVLGNI
LRKLVRNFNVENLEAEDLIEELQELLEDKRYFIVIDDIWDSTAWGRIAYAFPRNSCGSRV
ITTTRIERVARDCCKVECKNVYRMKPLGEVDSRTLFLRRTFGSEKDCPDTHRKEEILVDI
LKKCGGMPLAINSIASLLAGEPESTWEYVWKSLGALTEGDNLENMKQILDLSYIHLPDHL
KACLLYICMYPEDREIDKTELLRKWVAEGFVHVSTNGLLDAVDVAEKYFKELINMCMIQP
WRISYNNEVLSCRVHDIILDMMRSKSSKENFIHVIDGSKVEMGEIRRASVHYNDKKDTTI
LETINKGSLSHVRSVLLCRSSLLPYFLDFKYVRVLHLEHKYSLNNYLDLTGISGLFLLRC
ELKLPNKIEELQQLETIDIRVGKLREYPSDIVSLPQLSHLSSMGTMLPDGIDRLKSLCTL
QGVDMFKSSVENIKGLSKLTNLRELGISWNGSSESVEESTMDALDSSIRKLSANLRIFTF
KGGFAYKPDVPGWITRPPFHRDSHLRELNLGGCRFQRCPEWIGELHGLYKLGIVVREVAD
GVSIVARLPSLAHFYLIVSGMGEEEKEESVVIPGTGSGAFRALKQMLFNCPKVSLNFEAG
AMPKLEKLSLRFRHNMAPQFLPVGIQHLPAGTLKQIWLHVYSNQTQNKTSVRHLLEGAFK
QHHPSADITVDFI
Download sequence
Identical sequences N1QU93
EMT02356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]