SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT04690 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT04690
Domain Number 1 Region: 409-467,535-640
Classification Level Classification E-value
Superfamily HCP-like 0.00000000759
Family HCP-like 0.025
Further Details:      
 
Weak hits

Sequence:  EMT04690
Domain Number - Region: 158-271
Classification Level Classification E-value
Superfamily TPR-like 0.000125
Family Tetratricopeptide repeat (TPR) 0.067
Further Details:      
 
Domain Number - Region: 881-924
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000139
Family B3 DNA binding domain 0.014
Further Details:      
 
Domain Number - Region: 624-715
Classification Level Classification E-value
Superfamily TPR-like 0.0531
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT04690
Sequence length 943
Comment pep:novel supercontig:GCA_000347335.1:Scaffold93965:15387:23109:1 gene:F775_21062 transcript:EMT04690 description:"Pentatricopeptide repeat-containing protein "
Sequence
MTSVILDLIATKTKTPKNMTKCDGVGMTQVSVPEIDASGESNRKCGTVADNDAVVGGDRS
EGGKVTRMSKHESTYSGLISLSARHRRMEQAVGLYEEMRAHGIVPSNDTCASLLALYDKS
EDYSKALSRFSEMERSRVVIDGVIYGILIRIYGKIWLYDDAQRTFEEIDNMCFLSVEQTY
VAMAQVHMNAGNYGKALQVFGLMRSRNVKPLPFSYGALLRCHVAREDIAAAEDAFRALCK
YGLPDVFCCNDLLRLYVKLGQLEKASAFIRKMRKEDILLDEALCMTVMKVSCKSGMIADV
DKILKEMENEGVTMKNSTIVSMIEMYARSRTSVMQEQDSSSKALGCQTDHSTLDTTFRSL
LHTPLGSSIACQLIRKLSREGSTCEAKFLHEQLTELVVEPEDSATATLMVQYGQEQKLQQ
AVELFESASTLFPVGGPVYNAMVDALCKCGKIEEAYHLIMKMADQGQSKDVVTISILVNH
LTKHVNLVRRFAAVYTHIAKLLPAKFQEAENIIHAASMVKLSLIPSCTILLSSRCSSQVW
INIFSNCVYGLGGKLDKAAEMFTSAQELGLPIEEKIYTNMLNFYGKAGRHQDASLLFNRM
KELGIMPGKTSFNSMINAYATSRLHDKAEIVFQEMKSQGHTEKVDATPKLSHLIFAFLKE
GQIDEAQRICCQMQEIGVAVDLACCRAMMRAYLEHGRVDEGISLFETIRRSLKPNGFILS
ATFQLYVHSGREPEAGDVLEAIGLHGASFLRSLKGSSKFNLQIWRYNFSGGGRALKQIRE
QQVDLRPPSPASAAALRQWRSSMLLKFEHTIMVFSNLVRSPSERPKKKALHPMPQGKCWG
WGWGSWHWIDTENKGKEVVDKGKDVVPPSEIDTENKGKEVVDGRVTLDLGWATFAAIHPI
KIGYMVTFKLLTPDMLKVIVFNEDGIEVVTRCGKHDDAFAVNA
Download sequence
Identical sequences M8ASM3
EMT04690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]