SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT04827 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT04827
Domain Number 1 Region: 200-528
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 5.63e-69
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000435
Further Details:      
 
Domain Number 2 Region: 531-618
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 5.75e-24
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.001
Further Details:      
 
Domain Number 3 Region: 716-802
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.02e-17
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 4 Region: 928-1030
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-16
Family B3 DNA binding domain 0.006
Further Details:      
 
Domain Number 5 Region: 1139-1246
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000608
Family B3 DNA binding domain 0.0073
Further Details:      
 
Domain Number 6 Region: 49-129
Classification Level Classification E-value
Superfamily Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.0000000000144
Family Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT04827
Sequence length 1251
Comment pep:novel supercontig:GCA_000347335.1:Scaffold92887:53057:63479:1 gene:F775_23008 transcript:EMT04827 description:"Arginyl-tRNA synthetase "
Sequence
MGGEAASTSSSTPHSQPLETEATQCRVESVKRHLSRLVVKSLCAVAADFDVEPMLEVSKS
GFGDYQCNNAMSLFPRIRESATNLGNPNAVGQAIADNLPPSRIVESTSVVGPGYVNIVLS
SDWIAQSCLRLPGVVRGGHGAFSSMPSIMAALSAIVAHRLFLHTVHLCRAVGRGPVVITL
FAMIESPPRPAPRRSICSLDEMHVGHIRSTIIGDTLARIFEFANIEVLRRNHVGDWGTQF
GMLIQFLFEKFPNGEEAANQAIGDLQSFYRDAKKKFDENPDFKGRAQQAVVRLQRGEDRY
LAAWKSICQISRNEFDLVYKRLNVELEEKGESFYNPYIPRVLEELTGKGLITESKGARVI
EGRKPPLIVVKRDGGFNYASTDLAALWYRLNVEMAEWIIYVTDVGQQQHFHSVFSAARMA
GWLPDQKEEKYPKASHVGFGFVLGADGSRFRTRSSDGAVRLVDLLDEAKSQSLAQLIKRL
TENGQIAKWTDEELDKTSEAIGYGAVKYADLKNNRLTDYKFSYEQMLSDKGNTAVYLQYA
HARICSIIQKSNKDVEELKMTEFITLGHPDERSLGLHLIQFAEVVEQVCDDLSPHRLCDY
LYTLSERFSQFYTNCQTCQCLMISREYHDRFLQIPCQPKAACVHICIGTAESFSLNHRFL
LELLCQVHMAGLASQVKRYCDCYKRYAGHLDRKMRCFRGRMTANFRHGMDWLEFVMDNCL
QVIPNKFIDHFGGNISRTIELESRNGSMYTVEVSKLMNETVLRRRGWQAFVDAHGVEEND
SLLFRHIEKSCFEVLVLDSDDCEKVLPSAGIKVASCNAQESGSVDYIDISSSSGDDTTRS
PGSQRFATCERGDSSHPRKTAVINDSLPEEDSGEDTDAAEEHSEHKSSFELDDVRQTPSA
GRDYVLSRRGRLSGAQEERVTRLLQDVQAETPVFVAIMKMSTQNRTIVIPKLFAEEHFPR
ESQNLTLQRPGKSKKWHPWFSIRKDRCGHVLTGSRWVGFLRDNGVQEGDLCVFQPVQGTG
TRSKFTVHLLHESLGASRSTGPKKRVGCTTTHGNTRVNSAAPERATTAHGHGATTMAKAA
PPTPTTLRVNKQQDDGCNHGRQTQRTRQLPKLAPPYVISSAARLTEEQEREVDRTARAIG
SQVPVYVSVMNRSSVGVDNGIYNVTISGAYAADYLPAGERVAVTLVRRKKVWEVEMRARN
GGRTLAQGWCGFARDNRLRVQDVCLFQPMEKNHESLTMTVHIIRHSGKRQQ
Download sequence
Identical sequences M8BPD7
EMT04827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]