SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT04832 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT04832
Domain Number 1 Region: 210-362
Classification Level Classification E-value
Superfamily Mannose-binding lectins 7.06e-24
Family Mannose-binding lectins 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT04832
Sequence length 367
Comment pep:novel supercontig:GCA_000347335.1:Scaffold92863:19687:21276:-1 gene:F775_10027 transcript:EMT04832 description:"Uncharacterized protein "
Sequence
MDNFKITSYANALVENTKLDFQSLYLHRIRSGDKKNQYVVIDGVGATDICLTTINDWAIY
DGAAVDAKLVAHAKGMHMNAAAADCCNLFIIVFELDSFKGSTLAVMGATTEEQGEWAIVG
GTGQFAMARGVIQRKMHQKLADGQGDVLELTIEAFCRRKGQPEPPATTPQTPTTQPIQPP
VQPPPATTQPIQPPVQPPPAPTKPIQPPTPTPIKNGPWGGTTSDKLHHFNPNMSVGLKSV
TFIYYHAVNGLRFNYTGKDGYENSSELFGNNGHGPDAKRQTVHLGPREFVTELSGTHQHE
RRSNNIAIYSLKLVTNLGKTHGPFGSANIGAAFRFSVPPNSKIVGFFGGSTGYAVNSIGA
YTLENSA
Download sequence
Identical sequences M8BPE1
XP_020180424.1.58150 EMT04832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]