SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT04923 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT04923
Domain Number 1 Region: 181-306
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.88e-27
Family Ankyrin repeat 0.00084
Further Details:      
 
Domain Number 2 Region: 20-125
Classification Level Classification E-value
Superfamily PapD-like 0.00000000000000105
Family MSP-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT04923
Sequence length 330
Comment pep:novel supercontig:GCA_000347335.1:Scaffold92024:10812:12545:-1 gene:F775_14639 transcript:EMT04923 description:"Death-associated protein kinase 1 "
Sequence
MAAVKPACSVPANSADAAQTAPAPEPEQQLLEVAEEEVVIDFKPSSKCRVDLRLRSLHPT
LPVAFKVQTSSPLKFLVSPPRGALQPLSTATIRVVLRPQPHAPPSFPRSRADRFLVLSSL
SAAQLDSAASVPGGAGVGIGAIRLRFYSKLSLHISCQNVTTNDAFLADYVQKEGVDVLQR
WEQVMTAARRGALRSLEFLLSKRTGLRGRDQYGLTALHVAAIKGHCDAIALLAGSGCMGV
ECEDVEGHRPLHLAVEGGCADAVDLLLDMGADVHARTKRGATPLQMADTMGYDDISQLLR
GRGADEAAAAAGADAQLCIASSSSSSISCA
Download sequence
Identical sequences M8BDT3
EMT04923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]