SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT05021 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT05021
Domain Number 1 Region: 276-372
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-24
Family B3 DNA binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT05021
Sequence length 427
Comment pep:novel supercontig:GCA_000347335.1:Scaffold91378:16051:21396:-1 gene:F775_06506 transcript:EMT05021 description:"B3 domain-containing protein "
Sequence
MVAHEATAVATQPQWKPGILKWQFGGRGSPARGQLSEGDLARGNGADPAMNGGRGPGNGS
ELAARSHYDHGRVAGNRLSVSSPRDRFLLLVPLESSRDVTELNVCRSRRCRAFGTWIGWI
AKTFDYINRVNKRFRFRSTRRPGPGATAGAGGASGAGAAYEEERQKRILDNLKHLEDLGI
SKMAKSLIQATRQQHKTPRASPKSRKKFEATTEVRRSSRARTTVSYKDDFPELDDFVRRR
RVSKSVHSGRGYTGRISSYQQQQRAFKRAEKLQDSLDPDNPSFVKTMVRSHVSSCFWLGL
PSSFCKDHLPPREHKMVLEDEEGVEFDAVYIGNRTGLSGGWRGFSMHHDLEDGDSLVFEL
AEPDRFKIYIFKAIEDGKEAEPNDNNADVDSDSAQEVPDQTDSPVSEPPSSPEPLKGAKR
RKLRGRR
Download sequence
Identical sequences M8AKJ2
EMT05021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]