SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT05638 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT05638
Domain Number 1 Region: 602-839
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.01e-66
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 891-1011
Classification Level Classification E-value
Superfamily PapD-like 3.92e-26
Family MSP-like 0.01
Further Details:      
 
Domain Number 3 Region: 1591-1695
Classification Level Classification E-value
Superfamily PapD-like 0.00000000000000654
Family MSP-like 0.01
Further Details:      
 
Domain Number 4 Region: 1712-1813
Classification Level Classification E-value
Superfamily PapD-like 0.000000000000262
Family MSP-like 0.0065
Further Details:      
 
Domain Number 5 Region: 2016-2126
Classification Level Classification E-value
Superfamily PapD-like 0.000000000837
Family MSP-like 0.0086
Further Details:      
 
Domain Number 6 Region: 1843-1940
Classification Level Classification E-value
Superfamily PapD-like 0.00000000288
Family MSP-like 0.012
Further Details:      
 
Domain Number 7 Region: 2135-2235
Classification Level Classification E-value
Superfamily PapD-like 0.000000314
Family MSP-like 0.016
Further Details:      
 
Domain Number 8 Region: 1054-1154
Classification Level Classification E-value
Superfamily PapD-like 0.00000209
Family MSP-like 0.018
Further Details:      
 
Domain Number 9 Region: 1330-1429
Classification Level Classification E-value
Superfamily PapD-like 0.0000128
Family MSP-like 0.02
Further Details:      
 
Weak hits

Sequence:  EMT05638
Domain Number - Region: 1470-1560
Classification Level Classification E-value
Superfamily PapD-like 0.00249
Family MSP-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT05638
Sequence length 2286
Comment pep:novel supercontig:GCA_000347335.1:Scaffold86365:9231:31100:1 gene:F775_25204 transcript:EMT05638 description:"Putative cysteine-rich receptor-like protein kinase 39 "
Sequence
MPSYTEAPSESEEEEYVLDGEEEEGEEEEEAKEEEAEEGEEEEGEEGGRGEVDPELWGDL
PWCAPKGWLRGTAGVPSPPSIEAHKWLIEPSGTENWILHEKGRKPNDLITVLLKEFWSGL
FCPRPDRDPELRVLATSWAHYEAYSHAEYGTAAKEVITKFWQLYRVLDEHKARADVVLLA
AAKKKAHQLQYEVRWVAVSQYDHTYLHQKMTKTQAQRQRLTLSREQFMKVIPRWCYGKDD
GWASLVDRWLGDDAEFAAKSSKVRANRGKDGTHGQGNRNHSGFKAMKSQIDDTALVAIQG
KCLITPSVSYTRLRATNPSALESTGHSQPPLARQHVAYKAFVEHRNLEVREYLQRVKAND
DYNRQMMTAMLASWSNRTDPPQMGPPPPPAGEPPHMPTFDEWVALGSDSPSGAGLGGGGF
SGGGLGGGGFGGGGLGGGGFGRAHKLAWSPSWIQTPQEWSALCLNLCSSGGRGRGDDRVG
RTEPSALEAMMPTNKITGRTGNRLPDLRIALYVYVQFISVPSNENSERRVGTVQSTSSSA
CSPVHCYQGCLIPSCLVRNSLFGSMLRLSWFMMNCITFTRMDEAIMEHNVLERIFDGSIR
PTDLKLSALESITRNFSEERIVGMGGFGTVYKGVLRNGQVAVKRIKNNHTIDEKVFQREV
NSLFHVSHKNIVRFLGFCSHTEHKAIENEGSRAYIYAENRERILCFEYINNGSLENYITD
ELRGLQWDTRYFIIKGICDGLQYLHVEKQIIHMDLKPANILIDHNMVAKITDFGLSRMEE
NAQTKSTTRVSSPGYTAPEYIDKGKMSVKYDVYSLGIIIIELVTGHRSIPDSNNLEGLVC
LWLDSKIKAYSFDKEGSFHLNEHKAYEILGKVHLTVARHLGLFLQISPYLEDDMLGIEPL
ELCFPFELNSQISCSLKLTNETNDFIAFNVETTSPLPYCIQPNKGFVAPRSKFGVNITLQ
PLDKAPQDKYTGDFIVRSTRVNENLDDITEDIFKREEGKLVDEVNLTITYKAEEPQVDVP
LGSPIISDTGILHGPHVSTVLSTEAESKISASSSDEVIQFDPPELCFPLVPDKKVLSSVK
IINITDLYVSIAWSSPEENSAMYAVTSSLLIMPPRSTRWLTVTREEKEDAVKDMQFNDQV
FVWYTMVAEDIKVSDLDSEDYKEYKKLPVVLTKEDNPRPLHHDDACIHILLRMQNPAAEQ
HQSRNKAKRKAEAACLATCPNPTRIVPWSAVLGLPSCCQVGHYQIGIRVNSRRPIPSLLA
EVKKQRRHKAQLYGRRRIPYLAMLPNLLDPGTICVPRTKAHAHDPSEKGPATAFPGDIRT
LLEGASAMAMEEELIQFDPPELGFPCLNKTSLSSLNMVNITDCYVGFNSWSFMGIDAWYT
EPCRGILPPRSTQRMLVQCVPKENEAEEDMQCKKSIFLWNMIVAQGVESSCLIDQLSDED
SKELPVIFNNKISSPFTSASGDKLIRLDHPAGLAFPQNKTGLSSINIVNVTNYYVGFRLF
SKPGKDAAVTYHMFTEIGILAPRSDQRLAVARLTNEKETQDTTYNDDKLFIWNSIVSEGI
KVSDLDGYISLQIEQSIELPLIFDKITSSTSVEVIKFEPPQVCFPFLPSKRLLSSIKIVN
ITDYHIGFNTQVDETNVALYITEPPCGILPPGSTRELVVTRVAKEDAPELEDMQCKDKYF
VWSCVVTQDVNVSDLIRYMPEKERKELPIVFMETSSNELIQFDPPELSFPLLPNQRVLSS
TKIVNITDQYISFRVCTKKSNSARYNANPSEGILPPLSTQVILVTRIAEEKELEGTQCNG
KFLVWNGIVTEDAKASDVIDNMSETKCTGFLILLKQQTSSSISEELIQFDPPELHFPILP
NKKVLSSIKIVNLTDYNVGFNTYNRPTSVAWYHTEPPRGILPPRSTQKLMVTREEKEDAL
KYKQLNEKYSVWTGIVSECVKDSELSDCMAEQESKELPIVLDKISSLTSSDELIQLDPAE
LCMPHWPNKEIKFMASLSTSKELIQFEPPELSLPLMMMPNKPLVFSVNIVNSTDYYVGFD
GYNLKTNVAWYFTQPTGGIMPPRSTQRLVVKRVPKKKEELLSECQDDKFLVWSCLVSDGA
KAKASDLDLAGYGKYKGSKELPIVYTNKTSSLCTSDELIQFDPPQLPFTFLPNMRVSMLR
LLKIVNVTDHIVGFSAWPHEENSASYTIEPDAGILQPQSTQAIKVRRTPRKKDTEDIQCK
DRIFVWNGIVTQGVQVSDVGTDTTITLIDTTNNYRLPIYVDSLEKAVQGRTGMVESLGRK
DILSVG
Download sequence
Identical sequences M8BFX2
EMT05638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]