SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT05775 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EMT05775
Domain Number - Region: 132-170
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0143
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT05775
Sequence length 193
Comment pep:novel supercontig:GCA_000347335.1:Scaffold85190:3619:7246:-1 gene:F775_05196 transcript:EMT05775 description:"Uncharacterized protein "
Sequence
MGMWNYDKGDHLSSGKSGESSGLGINDEDCITTEAIDLHPPVIRRCTRWWRRLSGSEQGR
GGEEHSSMWSFFPWMVCTICHSHCESDNEQTFRIVIRDDYEALANIPCTERNMFNQMSGL
NYKADDRRYVFDVYRGHEATLIGGDDWTKFKRDFDVGQGNVVVFDMTGEQQREINEEHIS
LVCVVNALRPAEA
Download sequence
Identical sequences M8AVV3
EMT05775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]