SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT05921 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT05921
Domain Number 1 Region: 218-317
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.02e-22
Family B3 DNA binding domain 0.0033
Further Details:      
 
Domain Number 2 Region: 425-520
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.83e-18
Family B3 DNA binding domain 0.0058
Further Details:      
 
Domain Number 3 Region: 584-688
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.65e-17
Family B3 DNA binding domain 0.0074
Further Details:      
 
Domain Number 4 Region: 98-177
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.3e-17
Family B3 DNA binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT05921
Sequence length 698
Comment pep:novel supercontig:GCA_000347335.1:Scaffold84212:29229:33107:-1 gene:F775_06586 transcript:EMT05921 description:"B3 domain-containing protein "
Sequence
MAVQDPQASACMVCYSSAYIYVLALCLGIVGIVAGCLLLCRSISSSQRLLFCSGLGVSAS
WAYRLLLCISIGFLKELLGKVLDTFDLSDIEYMHPCEAIPQKFVDNFNGHISEVIKLEAP
DGNIYNIQAIRDLNKIVLGSGWGVFVSFYKLKAGYFLVFRYIRDSHFKVLIFDFGTCCEK
EVFHVLMNCGPDSQEKESNSESHRRCELCDVHFYWHHLDDRQKHFLRLMVGDFRQEMSIP
QKFVNNFRGRISEVMKLEAPDGNIYNFKVTKDLNKIVLRYGWAAFASDYQLKEHDLLVFR
YIGDSHFKVLIFDPSGCEKQLFNIVLNHAPNVPKTCISHDRSFLRETRRRDCGSHDNNSR
KTKKMTPVDSPSPRSEGVTSPEVTMNSAGLREITEPHYVLATGCNLTTAQKAEVDALVKK
VRPVIPFYITAMNKTSMSGSLVICKDYAAKYLPHEEQFITLCHPHKSNIWVDNLKVITDG
SCMLSVGWSCFVLHNELRESDICLFEVSKNDGEVTMVVHSLEGGHHLQGKGPESQNKCSY
PVKVEVTEEEESDKEHAESSYYYSRYAYDLTGEEQEEIFRSALIQQGNPVYVAVLQENHG
RNNLLTFPREFAAKHLAERSHDILLLRPNRREKWCVRYYYHSMMRIQGFSYRSWTKFVSD
NGLQEGHVCVFELMKGVCEATMMVHVFRKFNGRFVLLD
Download sequence
Identical sequences M8AN23
EMT05921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]