SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT06147 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT06147
Domain Number 1 Region: 32-127
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.62e-29
Family B3 DNA binding domain 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT06147
Sequence length 188
Comment pep:novel supercontig:GCA_000347335.1:Scaffold82556:40054:40957:-1 gene:F775_21292 transcript:EMT06147 description:"AP2/ERF and B3 domain-containing protein "
Sequence
MLRKHTYDDELRQGLRRGRGRAQPTPAWARELLFEKAVTPSDVGKLNRLVVPKQHAEKHF
PLKRTPETTTTTGKGVLLNFEDGEGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLGAGD
SIVFSCSAYASPPVAEAANGEQVRVVRLFGVDIAGEKRGRAAPAEQELFKRQCVAHSQHS
PALGAIVL
Download sequence
Identical sequences M8BT88
EMT06147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]