SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT06148 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT06148
Domain Number 1 Region: 34-134
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.66e-30
Family B3 DNA binding domain 0.0000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT06148
Sequence length 198
Comment pep:novel supercontig:GCA_000347335.1:Scaffold82556:41400:41996:-1 gene:F775_21293 transcript:EMT06148 description:"AP2/ERF and B3 domain-containing protein "
Sequence
MLRKHTYSDELRRGLRRGRGIGGRAEPTPSWAREPLFEKVLTPSDVGKLNRIVLPKQHAE
KHIPLKRAPETTTTADKAVLLNFEDGQGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLV
AGDVVVFSCSEYGHEKQFYIDYKKTTTVNSGASASPPPPVVETGKGEQARVVRLFGVDLA
GEMRGLAAPAELELFKRQ
Download sequence
Identical sequences M8BHD9
EMT06148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]