SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT06402 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT06402
Domain Number 1 Region: 5-187
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.79e-43
Family Protein kinases, catalytic subunit 0.00062
Further Details:      
 
Domain Number 2 Region: 474-678
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.88e-41
Family Protein kinases, catalytic subunit 0.00091
Further Details:      
 
Domain Number 3 Region: 713-842
Classification Level Classification E-value
Superfamily PapD-like 3.66e-20
Family MSP-like 0.02
Further Details:      
 
Domain Number 4 Region: 847-944
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.18e-18
Family WD40-repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT06402
Sequence length 1029
Comment pep:novel supercontig:GCA_000347335.1:Scaffold80962:42803:52861:1 gene:F775_00101 transcript:EMT06402 description:"Cysteine-rich receptor-like protein kinase 28 "
Sequence
MSLPLDFLKAITCDFSTESELGRGGYGVVYKGVLKGGKIIAVKKLFEIPLLDDISFQDEV
RYLIEIRHPNLVQFIGYCDGSNWELIRQPSGSFIYMEIPKSVLCFEYVCNKSLDKYISDE
SLDLDWNKRYDIIKGICSGLCFLHEECHILHLDLKPENILMDSMMMPKITDFGLSRLFGE
QQTRIFTDNPAGIQEYSTRILTSRCSLKQGRYLQSLACVDPAMEKRPRANGIVQVLSTAD
QMEAREELPLGMQCKDKSLVLYTTVSKELIPHSISEDIFSNETDGKVGNVKKLQQGLSPT
APLWELSTCSQNQQEAAKESSEPEQAIYRTSEMEAHKELPSDMQYTDKLLVVNTTASKDL
TPPSVTEDTFDTEIDGEVVDGTASENFSPKTLLELSTYRPNYQEELKKSSEPQLASDTTA
EVTASSSELLDAHPLELSFPVKPYAARESRYMDLEVLEHILDGREKPTNLSFTLLKNITE
NFSDNREIGNGGFATVYKGKLPNGNVAVKRIRNSHSINEMLFYREVDSLLNVEHKNVVRF
LGFCASTDQTAIRIEGSKEHIYAEVRERLLCFEYISNGSLQKYITDELRGLEWNTRYEII
RGICEDFGLSRLDQKSKTMSADRYGSLGYCAPEYLHQGKMSFKSDMYSLGVIIIELVTGE
KTIPSNNNNNEIDPSRRPFIWDMIKDIRQMEGVNGKISSAYANTFEEISPYSEDDMLGSE
PVELHFHFELNKQMSCSLQLTNETDSSIAFNVENMSPLPYCTQPQKDILPPRSKCKVEIT
LQPQGKALRDMYRANEFIVWSTKVNDDTAIEDITTDMFIKEADNVVDKVNLDVVFYTCDQ
QEATEKTSEVWTLDSPKSKYTLSGHKSGTSCLDFFTRDGQQYLISSSYDKTAKIWDMQQQ
QCLHTLEDVDMSQLTSVVSHPSLPVLIIGTRDGDVHVWSSTNFRSAEGKELPISELEPSP
AATMISDRALPGGDRDLTSSPPRQPRFPFDSKRCGFGGLLSRHAVHAASRDEEDRSSSAV
FRNRWREEE
Download sequence
Identical sequences M8BTY4
EMT06402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]