SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT06472 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT06472
Domain Number 1 Region: 16-114
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-21
Family B3 DNA binding domain 0.0021
Further Details:      
 
Domain Number 2 Region: 407-505
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000373
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 3 Region: 231-338
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000216
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT06472
Sequence length 536
Comment pep:novel supercontig:GCA_000347335.1:Scaffold80457:25204:27888:1 gene:F775_11908 transcript:EMT06472 description:"B3 domain-containing protein "
Sequence
MSNSCECCNRYWTHLHGKVKCFFTQMDRHSRHSMVIPERFVNYFGWKLSGTIELEAPNGS
VYDVEIAERRNKTLLRSGWEAFVDANHIVENDSLMFRYRGSCRFKVVVFDSSGCEKVVSC
ARILTNISDQEPSTNSADISTSFSDGNTPSSARARSDGCQSGSSGHLRKRAKKDAISYPS
EGSSAEDSPYEHESSEFDDQTLPTPLYVLSGNCYVTEEDEANIFALAQEIQPEMPLLVAM
MTKPSVKPYPDLVIPKDYTLAHFPHRNQTIKLQLPEQSKKWYCEFRVKSDGGRCNLKECG
FARDNHLLEGDLCVFQPMMNRKGRTFKVMVHLLRKASIDHPFGKNGLTSKKNAPTLCIKE
EPNDGEETPSLGHEEHGISDEEPYMMPRGTCLTQLQKKKILEKVEAIGSDLHIYIAVMTR
SSILVSLSFAIKYSATYLQKGSGSLVLQVEGKSQIWHDEMREKAGAMRIRAGWTSFASDN
NLREGDICLFELMKNEGGLKKMVVYIIPLAALFCGMKFKLVADEVCMRKPLIVCIL
Download sequence
Identical sequences M8BU54
EMT06472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]