SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT06474 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT06474
Domain Number 1 Region: 179-286
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-16
Family B3 DNA binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT06474
Sequence length 289
Comment pep:novel supercontig:GCA_000347335.1:Scaffold80457:34245:35314:1 gene:F775_01285 transcript:EMT06474 description:"B3 domain-containing protein "
Sequence
MAMTKRNGDMGSPCQRPWPCLIGLPAIPLRMILEDDEVRRAAIQFLNLLGNPRRWSRSSK
YSHLMVSKACASGTGPKRGSSTHGKTRVDSATPKRARTTDGRTRAKATSTTSVRKEPGDE
MFPGGNEPSLVHNHGHEARQGPVESNKSRGPRKRPYIISSTACLTREQEMYVDKRARSLQ
SDVPIYASVMNKSSVGDNSLYAVTICRKYAAEYLPAGAQTVTRLRAEKSKTWEVKVNPRI
GDAKMLRGGWREFAHDNHLKLKDICLFQLMTDQRKLTMMVDIIRHNEKR
Download sequence
Identical sequences M8AYK3
EMT06474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]