SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT06481 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT06481
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily Mannose-binding lectins 2.22e-18
Family Mannose-binding lectins 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT06481
Sequence length 155
Comment pep:novel supercontig:GCA_000347335.1:Scaffold80415:26781:27395:-1 gene:F775_23718 transcript:EMT06481 description:"Uncharacterized protein "
Sequence
MSTVKVGMFGGSNGDVCDITGLSSFPPSSLRSMEIWSTPGHEGVINAIRFTFVDTKNNAI
PVGPWGTPLRGQKSQTIHLTNVRVIELSGYTNGRYITSLSFRTTDAPRHHGPFGKVRPAT
GSDAYFRVPLMHGSIVAFCAQADDYLSAIGAYLKN
Download sequence
Identical sequences A0A1D5UUL6 M8APJ4
XP_020192672.1.58150 EMT06481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]