SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT06722 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT06722
Domain Number 1 Region: 229-344
Classification Level Classification E-value
Superfamily POZ domain 7.85e-21
Family BTB/POZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 125-212
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000000425
Family MATH domain 0.0037
Further Details:      
 
Domain Number 3 Region: 6-76
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000824
Family B3 DNA binding domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT06722
Sequence length 409
Comment pep:novel supercontig:GCA_000347335.1:Scaffold78800:16990:18537:-1 gene:F775_16650 transcript:EMT06722 description:"Speckle-type POZ protein "
Sequence
MPLDFTKHFVAVPTEFKLRNNIGCSWKVTVKLMNGRVTLDQGWATYAVVHQIKIGYMVMF
KLLTPDTLKVIIFDDDGIEVVNKCGKHDDAFAAKEQPNTRQCGSAHAARLSREVYAMQAL
LHTATKHALCVFIQLVSVSRDLPVVPDKGISAQGSLGLLNRTGKPVPLDTYTFSRRFTTN
EEGWYKFFTRSTLESYLKDDCFTLSCDITVTKLRAEETEDCDFVDLLWKEGADVTFKVGG
ETIAAHRWVLAARSLILKAAAEAELLGVPEREKKTTPMATVRIDDMEAKVFKALLHYIYT
DTLPDEMDKGDEAVTAMAHRLLGAADRYKVERLKLICEDMLCKRVSTSTVITTLVLAEQH
HSQRLKAACIDFLISPNNMKVVLENGGFKHLQSSCPSVLMDLIERAKVA
Download sequence
Identical sequences M8BUW9
EMT06722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]