SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT06878 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT06878
Domain Number 1 Region: 4-155
Classification Level Classification E-value
Superfamily Mannose-binding lectins 5.76e-20
Family Mannose-binding lectins 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT06878
Sequence length 157
Comment pep:novel supercontig:GCA_000347335.1:Scaffold77817:60316:60947:-1 gene:F775_29607 transcript:EMT06878 description:"Uncharacterized protein "
Sequence
MSTYGVKVGMFGGSNGDVYDIAELTSSAPSSLRSLEIWSTSGHEGIINAISFTFVDSKNH
MNKAGPWGTPLPGQKSKTIHLTNVRITELSGYTYDGYITSLTFRTTDAQKHHGPFGKVRP
KAGADTHFRIPLMNGSIVAFCAQADDYLSAIGAYLKI
Download sequence
Identical sequences A0A1D5UYR8 M8BJD9
EMT06878 XP_020148127.1.58150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]