SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT07124 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT07124
Domain Number 1 Region: 23-87
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000141
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT07124
Sequence length 131
Comment pep:novel supercontig:GCA_000347335.1:Scaffold76279:25500:25895:-1 gene:F775_08317 transcript:EMT07124 description:"B3 domain-containing protein "
Sequence
MAASFIINCSCPDLLCFLRLTVQIIPTHFQRRLPARRAAVVLRCRGSSWIMSYCGDTKLK
RLDQGWADFAVQNRLQVGDACVFELVSGYAGDGGNREVVLEVQVLRGGGLPEPEDLATKG
DTAEEAIAILD
Download sequence
Identical sequences M8BK20
EMT07124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]