SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT07265 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT07265
Domain Number 1 Region: 398-500
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.02e-19
Family B3 DNA binding domain 0.0067
Further Details:      
 
Domain Number 2 Region: 74-167
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-17
Family B3 DNA binding domain 0.0015
Further Details:      
 
Domain Number 3 Region: 186-269
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-17
Family B3 DNA binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT07265
Sequence length 629
Comment pep:novel supercontig:GCA_000347335.1:Scaffold75462:7146:11929:1 gene:F775_00306 transcript:EMT07265 description:"B3 domain-containing protein "
Sequence
MGEGDGDVLMHAGGQRGGHGGHAVSALHALSMGSRKLSDTQENRPPAGWGAGKKMCTSCE
RCKVRDGYSYKHLDDAKKHFLVLMLGDFRDEMIPEELVRRFKCEIPGEIKLVTRKGYSHT
IVVSKNQEKLVFTVGWRQFVGNYDLQMGDSLIFKYNRNSQFEVIIFDKLDREKALSVVQD
PFMPQIIPEEFVRRFKGEFPREMILETKNRCSYIIGVAKNKEKLVLTVGWGKFVETFGLE
MGDTIVFRYNGNSQFSVIIFDKLGCEKALSVVPDLFPPPVQERCTNATDTVKSSQPIQMQ
PFGESFLSEDSHGACDVPDSNYFLRKKKANLSSFLCEEESFSSEDGYGVRDACVKKKKAT
LSSSQKEQLKDGYITVHKAKLSPAQKEVVKQKVQSIHSEIPIFVAVMGKMNLDSRFVLTL
PSQYAKKYLGEEPRLYLQLLGDKWEVGFPDNTGDRRIVSGWKQFAQDNNLKMGDICLFEL
LSNQKRTMEVYIIPATDYNYSAGVQNDVDQEALEGGSAPLQREALAHHADGARDPDSRLL
RITNTDAWKMMLPLLVPDSPKEKPVVSEPSIPAVFALWGKQAFPSITRARLRRKLKLFCY
LRSRSRLVMHADWNSPSCSFSCFNPGSIM
Download sequence
Identical sequences M8B138
EMT07265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]