SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT07330 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT07330
Domain Number 1 Region: 191-433
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.62e-60
Family G proteins 0.058
Further Details:      
 
Domain Number 2 Region: 742-885
Classification Level Classification E-value
Superfamily Mannose-binding lectins 1.09e-40
Family Mannose-binding lectins 0.00017
Further Details:      
 
Domain Number 3 Region: 416-659
Classification Level Classification E-value
Superfamily RNI-like 0.000000000102
Family 28-residue LRR 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT07330
Sequence length 885
Comment pep:novel supercontig:GCA_000347335.1:Scaffold75091:13750:19904:1 gene:F775_33281 transcript:EMT07330 description:"Disease resistance protein RPM1 "
Sequence
MEVMAGAVLSALLHKLDAVLTDEYRLQRSLRGEIMFLRAELESMQAALERVSSPSAQPVD
RQVRIWAGQVRELSYDVEDSIDRFMVRVDLHHPGFSGFIGRCLSLLTTARVRHRIATDIR
GIRGLVKEVADRRGRYRVDDGAFAVRRPAGATVDPRLHGMYEDSARLVAVGGPRAELCRL
LVEQEGAGTMDGQLKVVSIVGVGGLGKTTLANVVYQQIRGRFDCDAFVTVSLKPDLRRVL
GSLLRQVSKQSYSEVEAWDVVELIDKIRQVLQDKRYLIIVDDIWDESAWNCIKTVLVENN
CSSRVITTTRIAGVAASCSSSIDGNIYKLNPLGHDDSKKLFHERIFGSEDGCHVKLREIS
QKIIRKCDGVPLAIITIASLLSHKSKNIHEWDTVNKSIGSGLEKFPNMENMRQILSISYY
DLPSHLKPCFLYLSVYPEDYAILSDHLLRKLVCLYIETSVRLPDGIGAMKSLQVLSTVGV
GASPNFSKELGYLTDLRILKISLSGTWDKNYEKHLLCSLCKLTKIKEISIQSSGVPTKFI
VDLGWTPHNLRYFFGNIPRLPEWMNSSLSELSTLIITLDKIQQEDLGTLGNIPFLHYLCV
TVHKIKKAEERLIIGTDHANFKCLSEFHIHNDSLGIMFVEGAMPRLQTLEVTFQVREAKD
EYNNFEVGLENLHSVKLVTIRMHCCGSSLIEVEEAGAAMRKTSYVNPKHPRVDVIRYYED
EMIEDEEKSQLDEEAFKEQEIILEKIGPWGGNTGRKRDIKVAPRYLRSVRICCGDVIDAF
AFSYLDKNENLHETPLWGGVGGTIHTILLEPSELVLEISGTFGPYGQFPSIIKSLMLVTN
LRTYGPFGQLHGTPFHSRVKKNGTIVGFFGCSGEFLDAIGVYIHP
Download sequence
Identical sequences M8B188
EMT07330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]