SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT07331 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT07331
Domain Number 1 Region: 226-425
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.23e-41
Family Protein kinases, catalytic subunit 0.0011
Further Details:      
 
Domain Number 2 Region: 454-578
Classification Level Classification E-value
Superfamily PapD-like 7.85e-18
Family MSP-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT07331
Sequence length 583
Comment pep:novel supercontig:GCA_000347335.1:Scaffold75091:32359:36944:1 gene:F775_21242 transcript:EMT07331 description:"Cysteine-rich receptor-like protein kinase 26 "
Sequence
MASIIIRTTIIQDNCPDIIVLDLAPNRKCSSKSTYKLCLQDIQTQPRNRPFQVSHQVKAL
LKQLWKQKLMDPREDFSLEIASESPSNRSPDVIVFSREGAHSQIREALLQLIFLLMVLRS
ILMILLGAQKFQCVQQTHILTYLYGWFIGLLKTFKIKEQAIRESGEQKQANQQLVTSSSL
DLKVAALGWVPHRQGENNTIISFYLSPEKFVEHKGELIRAKAMEGVLCFEYMQRGSLEKY
IGDESCKLDWRTCYEIIKGTCEGLNHLHMQKNRIFHLDMKPANILLDNSMAPKIADLGLS
KLVSSTITYKTEVKKGTYGYMPPEYINNGFISDKFDVSSLGVIIIKIVARNTGHVSCFEM
SQEEFIELVRKVSKYWKEKMQAVSGYSSHEIYILQVRRCTEIALRCISKDRKERPNIDEI
VLELEELEVETKKNALPFDGSKYLILKRSCATNDVAVDPALELRFLFEPRKEVSCCLQLT
NKTDGFLAFNIKVNKNKYRAQPSISTMPPCSKCYVIVTLRPQGAAPPNMQCHDMLLVQST
SISEQLASEDTQISYQEVFKTTLAEKVVDEVKLPIVYVALLDG
Download sequence
Identical sequences M8B028
EMT07331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]