SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT07336 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT07336
Domain Number 1 Region: 195-340
Classification Level Classification E-value
Superfamily Mannose-binding lectins 5.36e-37
Family Mannose-binding lectins 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT07336
Sequence length 345
Comment pep:novel supercontig:GCA_000347335.1:Scaffold75057:3579:4964:-1 gene:F775_29709 transcript:EMT07336 description:"Uncharacterized protein "
Sequence
MSPQSFTLETTTTTPAAKGSDPSYFQSAPAGHEMIQHKELLLHLYAYQNVQKTPDANQAV
IVESKRPECFGILAANDWTVYDDPAHNANLVAHAQGLHLGASMAKENWFICFNMVFVNQR
FTGSSFKVMGDFQGTAHNGEWAIVGGTGEFAYAQGVIAFKKTQQSERNARIELHVRAMCL
SFLRPLLSLGDGSAVAKIGPWGKMSGELLDIPSTPRRLERITIRHGVVIDSLAFSFIDKA
GEPYNVGPWGGPRGDNKDTIELAPSEIVTEVSGTVGIFAEDNVEYNAIASLTITTNLCPY
GPFGETQSTPFSVPVQDNNNIVGFFACAGKYVEALGVYVRSPVST
Download sequence
Identical sequences M8B033
XP_020166346.1.58150 EMT07336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]