SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT07620 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT07620
Domain Number 1 Region: 169-316
Classification Level Classification E-value
Superfamily Mannose-binding lectins 3.4e-39
Family Mannose-binding lectins 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT07620
Sequence length 319
Comment pep:novel supercontig:GCA_000347335.1:Scaffold73559:11749:13148:1 gene:F775_29169 transcript:EMT07620 description:"Uncharacterized protein "
Sequence
MAKANPSYYQTTAAVSAPVQYQEHLFHLFVQQQLEATNGANQLITVNPKLPQGFGVTVAT
DWDIRDGPEITAKVVARAQGLHQGSGKSSGAWFMSFNTVFTDERFKGSSLSVQGHLVSDE
GEWVVTGGTGEFAFAQGVVTYKKIKELAGGNIRELRFRVVCFNFPKPNTLTKVGPWGGNG
GTPFEIPQAELPQRLESVTIQSAEVIDSIAFTYIGLDGARRTVGPFGGGGGTKQPILQLG
PSESLKEIFGTTGNFLGLNIVTSLSIVTNVKTYGPFGKQSAGNTPFRTTAPDRHSIVGFF
GRAGQFVDQLGAYVRPTPN
Download sequence
Identical sequences A0A1D6S059 M8B201
EMT07620 XP_020149643.1.58150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]