SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT07650 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT07650
Domain Number 1 Region: 175-315
Classification Level Classification E-value
Superfamily Mannose-binding lectins 1.44e-35
Family Mannose-binding lectins 0.00017
Further Details:      
 
Weak hits

Sequence:  EMT07650
Domain Number - Region: 17-60
Classification Level Classification E-value
Superfamily RING/U-box 0.0424
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT07650
Sequence length 320
Comment pep:novel supercontig:GCA_000347335.1:Scaffold73419:7941:9168:-1 gene:F775_00527 transcript:EMT07650 description:"Horcolin "
Sequence
MEKNDTSETMITVDVDPEALNCPRCLRPLEPPVFQCAAGHVVCSTCHGDLPDKDRCGSCF
VNSGFSRCFIPTSYGRCLALERVLQSVRVACPHGCAATKMLYHEKADHQKTCAGSSAAVE
QPAVLLQQGPPGDCSYELVLPKVLPSSRASVTVTITGDDVGKKKICDSGKSTMGSLVRMG
PCGGIGGNVRETSMSDVNRIVEVIIRHGNAVDAISVMYERKGKEAWTDRWGGEGGKPAPF
SLQQDEYLTSVHGHYGQFKDTVVIRSLTLVSNLRSYGSYGKEDGVPFALHAGPGGKIIGF
HARSGQFLDAIGTYVKMDNS
Download sequence
Identical sequences M8B232
XP_020199433.1.58150 EMT07650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]