SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT08004 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT08004
Domain Number 1 Region: 4-108
Classification Level Classification E-value
Superfamily PapD-like 2.59e-35
Family MSP-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT08004
Sequence length 208
Comment pep:novel supercontig:GCA_000347335.1:Scaffold71305:28870:32080:1 gene:F775_09815 transcript:EMT08004 description:"Vesicle-associated membrane protein/synaptobrevin-binding protein "
Sequence
MGSDSKELLGIEPLELRFPFEFMKQISCSMELTNRTDDYLAFKVKTTSPKKYCVRPNSGI
VPPRSTSSVVVTMQALKQAPPDMQCKDKFLVQSAVVTEGTAVKDITGEMMQATRESDEPP
LSSVSILTSSAVFLAHKEPSEITTETSPLISRLTEERNSAIQQNNKLREELDLVRREISK
QNGNGGFPLVFVVAVALLGILLGYLMKR
Download sequence
Identical sequences M8BMJ8
EMT08004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]