SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT08188 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT08188
Domain Number 1 Region: 20-111
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000049
Family B3 DNA binding domain 0.014
Further Details:      
 
Weak hits

Sequence:  EMT08188
Domain Number - Region: 190-264
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00589
Family B3 DNA binding domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT08188
Sequence length 287
Comment pep:novel supercontig:GCA_000347335.1:Scaffold70376:56887:58040:1 gene:F775_25032 transcript:EMT08188 description:"Uncharacterized protein "
Sequence
MECTNCFHTRDLCVGNVGLENGCFYLTLLEGFKWMACIPCFARPNLLRKLKVAMDKGTGT
TAYLCTKEGFSFKTTILNEKDRTYFGCSNWGAFAKAYKFEEGMAIHFDFSKYSDSHPDIL
VDLENIPILPPSYFLAPKTTQEIVDSTYYTADSVLTWEEKNYLVSFVDGIECFTNTHNDG
KNYASYVPLVHALNKTNIQNKCLKLPRCVVPEIMDGNGEMTLIYDDKTNFKDTYSTAALP
DGRLLVNGWRRILKECNLEIGARLISVLHHGSAGIFLYLTSIPKRED
Download sequence
Identical sequences M8BZ21
EMT08188 XP_020184089.1.58150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]