SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT08321 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT08321
Domain Number 1 Region: 152-428
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.1e-62
Family Extended AAA-ATPase domain 0.041
Further Details:      
 
Domain Number 2 Region: 492-718
Classification Level Classification E-value
Superfamily L domain-like 1.07e-27
Family Internalin LRR domain 0.026
Further Details:      
 
Domain Number 3 Region: 814-898
Classification Level Classification E-value
Superfamily Mannose-binding lectins 6.67e-21
Family Mannose-binding lectins 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT08321
Sequence length 1108
Comment pep:novel supercontig:GCA_000347335.1:Scaffold69624:38959:48056:1 gene:F775_05820 transcript:EMT08321 description:"Disease resistance protein RPM1 "
Sequence
MDVLLPKLAELLTDEFKLHKGLKEEIASLSRELESMQAALVKISEVPVGQLDGQVKVWSR
EVREMSYDIEDSIDTFTVRFGAAQEPPEPLGLIKGFMDRVRSLWATALTRRQIAGEIHRI
KGEVEEVSQRRKRYKLDDDLVRPSAATTIDPRLPALYEDASRLVGMERPTGDLVKWLKEG
EGASKRQLKVLSIVGVGGLGKTTVANTVFHMLEGQFQCRAFVSVSLTPDVKKIFRSIIRQ
VSGEDCTNGEDWDVKELVDHIRNFLKDKRYLIIIDDIWDQNVWTILKVALIKSNCGSRII
TTTRKVGVAESCCSDFNGRVYHLAPLSHGDSKKLFYKRIFNCEDDYPNALKEVSEKILKK
CDGLPLAIITIASLLASKPTKTNELWYNVLNSIGSGHENGPSVENMRGILSLSYRDLPPH
LKTCLLYLSIFPEDHMINRDKLIWGWVAEDFIHDKQRENLYKQGENYFNELINRNMLQPV
DIDTHGSAKTCRVHDMVLDLITSLSAEENFVSILGGQQPLSTGNKIRRLSIQENNGEHNM
LDKSMDLSHVRLLFVFRSAIDMIPSLLSFQVLRVLDLEECQHLDSCYLKDITNLLHLRYL
GLGRTYITELPKEIGNLQYLQTLDLRETKIHELPSTVVQLRQLVRLYVSIGTRVPVGIGN
MESLEELSKINISESPNFVKELGTLTELRVLEIWANGWDSSYEKPFLEYLSSLHKIQILS
VFAADVLLDFTSEEEPGWYLHKELCRDFKGSVKRVRIDIDCDGAWVSEVEALEILIKKTT
NVYAPILNISRRLEEDMLKHEDIGLANKKEENWPAKNGPWGGNGGRARDIKVAPQSLESV
TIRSGSVVDSLAFSFKDGNGRHHTAGPWGSDGGSGKTIKLGPTEFVTEVSGTFGSFETAS
ANQLLGLLRQQSCDICGFSYLLSAPPSVRLVSGGLRAMEARWISALTDGRAGKALFAVVS
SRFVRVCVLLRKTRRRWLPDDGIGFSPQPPVRMVCLDHRWACGVTTLTPDAPATHNDNIK
NNILGKFQESQLSFIIERKIYLYVYLEDLYTIIVVQRYNPRKDASEFLLVFHYTTITWEV
EWFPIQEIPGVEHIMESYPKKDLVSEHI
Download sequence
Identical sequences M8B2V9
EMT08321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]