SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT08561 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT08561
Domain Number 1 Region: 33-108
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.01e-28
Family B3 DNA binding domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT08561
Sequence length 586
Comment pep:novel supercontig:GCA_000347335.1:Scaffold68500:36330:40092:-1 gene:F775_06493 transcript:EMT08561 description:"Auxin response factor 14 "
Sequence
MEQYPCELANKMFRQNVRESASEEGEDEMAGGDGEKKPRMPHMFCKTLTASDTSTHGGFS
VPRRAAEDCFAPLDYKQVRPSQELVAKDLHGTQWRFRHIYRGERGDDGELRLGVRRAVQL
RNEALFRAVNSNESKLHTLSAVASSLENRSIFHVCFDPRSGASEFIVPYWRFSKSLNHPF
SIGMRFKDSNDSDDANERSTGLISGISEVDPIRWPGSKWRCLQYFRDQVRWDDGNHCNHQ
RRVSPWEIERIGGSIQVNDCLSASSSKRAKLYFPQGNLDAPVTDGNDFPDPVETGSFHRV
LQGQELLMGSRAQGAARSRSPDVAKFRPPDHQRFSANAGSYMPQQSPAEFPYHSSGFGES
LGFPEVLQGQEMSRALRFYSQGSAFDARAQHGPFGYAQRSAAPGGLSPAAQGYALGQFTP
SSAAAKVSSPSSVLMFNQATVPQFDLEGRTSGYRGAYGGQCPPGIEMVRETEEAWPCAQR
RTPSVTGTGCRRFEEWIMASTPARADGGRPRSAAAGDVVGRRSCRLVGVSLTDQKGLGGA
GEGAAKEGDAADEAVEGADPRGLDLFGRGHPAPAALHAIVAAPLGM
Download sequence
Identical sequences M8B3I2
EMT08561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]