SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT08562 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EMT08562
Domain Number - Region: 277-352
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0167
Family B3 DNA binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT08562
Sequence length 377
Comment pep:novel supercontig:GCA_000347335.1:Scaffold68497:53380:59822:-1 gene:F775_24589 transcript:EMT08562 description:"Uncharacterized protein "
Sequence
MAPLFITGAMAVLGGGPPMPESESIRLSDSDQFLRCTPHKEDASGLLHELVLADFILCLF
APRGSLLVRGTSVVNQQGFRFPFVLQALLSLLLLPSLARHLLAIKLCEISFVISLNVKNN
QGTLSKSIELPKKHSPFKRRLHFNRVWPHLSVSWVRGGLVVLGHGLLWLSLFIYLFLKNK
DIAKDYSVFLCDVWLPDRLIFSLPMTAVKQEEANTTGDISGGQITHAEPLCCKHNKPFEY
IHRPGKAGSIQKFKGKKIQLKPGKLRKIIRTTTTPDRYYVCHMPETFATNDKRMYFSVPF
STGSFFPHMDADHGELSITTGDGTTAVTTRFIKGVDKRATITKGWSNFRQAHMSEGQAYA
FAFKCTSKGLRLIVYSI
Download sequence
Identical sequences M8AVR6
EMT08562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]