SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT08764 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT08764
Domain Number 1 Region: 232-290
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000471
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 2 Region: 6-108
Classification Level Classification E-value
Superfamily F-box domain 0.00000000301
Family F-box domain 0.01
Further Details:      
 
Weak hits

Sequence:  EMT08764
Domain Number - Region: 97-132
Classification Level Classification E-value
Superfamily Kelch motif 0.0327
Family Kelch motif 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT08764
Sequence length 291
Comment pep:novel supercontig:GCA_000347335.1:Scaffold67528:7019:16443:1 gene:F775_44068 transcript:EMT08764 description:"Uncharacterized protein "
Sequence
MAPDPAVLPGDVLAEILRRLAPHSLATSRLVCSAWRDTIDARLRAHLLPCSMRGIFINFT
RLRFSEFFSRPTTGPAICGGLDFLPCMGVSVMDHCNGLLLCCGLRHDNALPRDYVVNPAT
RRWARLPQHPRPHMPGSDESAYLAFEPGVSPHYEVVLIPLVLSAGVSNDDALLGSEWPPA
SYVIDVFSSVTRWWDKMTFVREGETKMTFVHLEPGSAPAPGHGDNGALEGESRTWDTELQ
RKTDHTAIVEGWASFAGGNRLQEGDICLFKLMESEEPLKMMVYIIRAEECT
Download sequence
Identical sequences M8BPT3
EMT08764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]